General description
The gene BTG family member 3 (BTG3) is mapped to human chromosome 21q21.1. It belongs to the BTG (B-cell translocation gene) anti-proliferative protein family. The expression of BTG3 is cell cycle dependent and peaks at the end of the G1 phase before the entry of cells in S phase. BTG3 transcript is ubiquitously expressed in adult mice, with highest levels in the heart, lung, kidney, and testis, but low in the spleen and skeletal muscle. BTG3 is also detected in the ovarian fiber cells and fallopian tube. The protein is mainly localized in the nucleus.
Immunogen
Protein BTG3 recombinant protein epitope signature tag (PrEST)
Application
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST73921
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| enhanced validation | recombinant expression Learn more about Antibody Enhanced Validation |
| technique(s) | immunoblotting: 0.04-0.4 μg/mL,immunohistochemistry: 1:50-1:200 |
| immunogen sequence | VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT |
| UniProt accession no. | Q14201 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... BTG3(10950) |

