General description
Apolipoprotein C3 (APOC3) is a 79 amino acid protein with a molecular weight of 8.8kDa. It is present on high density, low density and triglyceride-rich lipoproteins. The gene encoding this protein is localized on human chromosome 11q23.3.
Immunogen
APOC3 (NP_000031.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Biochem/physiol Actions
Apolipoprotein C3 (APOC3) is involved in the metabolism of triglyceride-rich lipoproteins. It may have a role in atherosclerosis. The protein stimulates hypertriglyceridemia (HTG) by inhibiting the activity of lipoprotein lipase and interfering with the binding of APOB or APOE to hepatic receptors. It also promotes very low density lipoprotein (VLDL) assembly and secretion in the liver.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 8H7, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~34.8 kDa |
| species reactivity | human |
| technique(s) | immunofluorescence: suitable,indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2aκ |
| NCBI accession no. | NM_000040 |
| UniProt accession no. | P02656 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... APOC3(345) |
