General description
The gene HRSP12 (heat-responsive protein 12), also referred to as p14.5, is the human homolog of rat perchloric acid-soluble protein (PSP) and belongs to a family of small proteins called YjgF/YER057c. It contains a GC-rich promoter and has been mapped to human chromosome 8q22. The protein is 137 amino acids long and has been isolated from mononuclear phagocytes. Its expression increases when monocytes differentiate to form macrophages. This protein is most abundantly expressed in hepatocytes and renal distal tubular epithelial cells.
Immunogen
reactive intermediate imine deaminase A homolog recombinant protein epitope signature tag (PrEST)
Application
Anti-HRSP12 antibody produced in rabbit has been used for immunoprecipitation. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
The gene HRSP12 (heat-responsive protein 12) encodes a trichloroacetic acid–soluble protein p14.5 that functions as a translational inhibitor. It participates in several cellular processes, such as differentiation-dependent regulation of protein synthesis in hepatocytes, renal tubular epithelial cells, smooth muscle cells, and mononuclear phagocytes.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST76244
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | mouse, rat, human |
| enhanced validation | independent Learn more about Antibody Enhanced Validation |
| technique(s) | immunoblotting: 0.04-0.4 μg/mL,immunohistochemistry: 1:1000-1:2500 |
| immunogen sequence | GCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGP |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... HRSP12(10247) |

