Immunogen
DNA ligase 4 recombinant protein epitope signature tag (PrEST)
Application
Anti-LIG4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
LIG4 (ligase IV) gene encodes a DNA ligase that links single-strand breaks in a double-stranded polydeoxynucleotide. The reaction is ATP-dependent. It is involved in the ligation step during non-homologous DNA end joining (NHEJ) and V(D)J recombination. NHEJ pathway repairs double-strand DNA breaks while V(D)J recombination involves the breakage and rejoining (dependent on NHEJ) of double-strand DNA.The protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), which improves the joining activity of LIG4. This complex interacts with DNA-dependent protein kinase complex DNA-PK. This interaction is required for NHEJ. Defects in this gene cause LIG4 syndrome, characterized by immunodeficiency and developmental and growth delay.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST78242
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | mouse, rat, human |
| technique(s) | immunohistochemistry: 1:200- 1:500 |
| immunogen sequence | TYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYA |
| web metadata keyword.default | 1:200 dilution Anti-LIG4 antibody immunohistochemistry,1:500 dilution Anti-DNA ligase IV antibody rabbit,Anti-DNA ligase 4 antibody rabbit Immunohistochemistry,Anti-DNA ligase 4 antibody,Anti-DNA ligase IV antibody produced in rabbit,Anti-LIG4 antibody rabbit Sigma-Aldrich,Anti-Polydeoxyribonucleotide synthase [ATP] 4 antibody rabbit,HPA validated LIG4 antibody for scientific studies,LIG4 antibody Prestige Antibody Human Protein Atlas,LIG4 antibody for cancer research applications,LIG4 antibody immunofluorescence assay,high-quality Anti-LIG4 antibody for research,rabbit Anti-LIG4 antibody for western blotting,validated Anti-LIG4 antibody for tissue analysis |
| UniProt accession no. | P49917 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... LIG4(3981) |

