General description
Peroxiredoxin 2 (PRDX2) is an antioxidant protein that belongs to the peroxiredoxins family. It is associated with mammalian erythrocytes. The PRDX2 gene is mapped to human chromosome19p13.13.
Immunogen
PRDX2 (AAH00452, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Application
Monoclonal Anti-PRDX2 antibody produced in mouse has been used in western blotting (1:1000).
Biochem/physiol Actions
Peroxiredoxin 2 (PRDX2) effectively neutralizes hydrogen peroxide (H2O2 ). It is regarded as a critical cell survival modulator and may serve as a key regulator for cell proliferation and intracellular signaling. Downregulated expression of PRDX2 is observed in acute myeloid leukemia (AML) and melanoma. However, it acts as an oncogene in the pathophysiology of various cancers including non-small cell lung cancer (NSCLC), esophageal, cervical, gastric tumors, and many more.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 4E10-2D2, monoclonal |
| form | buffered aqueous solution |
| species reactivity | human |
| technique(s) | immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable,indirect ELISA: suitable,indirect immunofluorescence: suitable,western blot: 1-5 μg/mL |
| isotype | IgG1κ |
| GenBank accession no. | BC000452 |
| UniProt accession no. | P32119 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... PRDX2(7001) |

