Immunogen
The immunogen for anti-JDP2 antibody: synthetic peptide derected towards the N terminal of human JDP2
Biochem/physiol Actions
JDP2 is a component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. It is involved in a variety of transcriptional responses associated with AP-1 such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris. It can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN. It may control transcription via direct regulation of the modification of histones and the assembly of chromatin.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: LPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVK
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 19 kDa |
| species reactivity | human, horse |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NM_130469 |
| UniProt accession no. | Q8WYK2 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... JDP2(122953) |
