General description
Hey1/HESR1 (hes related family bHLH transcription factor with YRPW motif 1) is a basic helix-loop-helix transcription factor that belongs to the HES family. It is located on human chromosome 8q21.
This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. (provided by RefSeq)
Immunogen
HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG
Biochem/physiol Actions
Hey1/HESR1 (hes related family bHLH transcription factor with YRPW motif 1) participates in the progression of brain tumors. HESR1 is required for the initiation of a tubular network and to maintain mature and quiescent blood vessels. Overexpression of Hey1 results in osteopenia and chondrocyte hypertrophy in bone.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 3B3, monoclonal |
| form | buffered aqueous solution |
| species reactivity | human |
| technique(s) | immunofluorescence: suitable,indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2aκ |
| GenBank accession no. | NM_012258 |
| UniProt accession no. | Q9Y5J3 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... HEY1(23462) |

