General description
NPAS1 is a basic helix-loop-helix transcription factor that that regulates branching morphogenesis in mouse embryonic lung tissues. Studies in mice have reported that NPAS1 deficiency can result in behavioural and functional abnormalities.
Rabbit Anti-NPAS1 antibody recognizes human, mouse, and rat NPAS1.
Immunogen
Synthetic peptide directed towards the C terminal region of human NPAS1
Application
Rabbit Anti-NPAS1 antibody can be used for western blotting at 2μg/ml. It can also be used for IHC at 4-8μg/ml, using paraffin-embedded tissues.
Biochem/physiol Actions
NPAS1 is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: TIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 63 kDa |
| species reactivity | rabbit, human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| web metadata keyword.default | 2-hydroxy-3-phenyl-4H-pyrazino[1,2-a]pyrimidin-4-one CAS number,2-hydroxy-3-phenyl-4H-pyrazino[1,2-a]pyrimidin-4-one applications,2-hydroxy-3-phenyl-4H-pyrazino[1,2-a]pyrimidin-4-one chemical structure,2-hydroxy-3-phenyl-4H-pyrazino[1,2-a]pyrimidin-4-one chemical,2-hydroxy-3-phenyl-4H-pyrazino[1,2-a]pyrimidin-4-one for research,2-hydroxy-3-phenyl-4H-pyrazino[1,2-a]pyrimidin-4-one synthesis,2-hydroxy-3-phenyl-4H-pyrazino[1,2-a]pyrimidin-4-one,ACS grade 2-hydroxy-3-phenyl-4H-pyrazino[1,2-a]pyrimidin-4-one,Sigma-Aldrich 2-hydroxy-3-phenyl-4H-pyrazino[1,2-a]pyrimidin-4-one,high purity 2-hydroxy-3-phenyl-4H-pyrazino[1,2-a]pyrimidin-4-one,laboratory-grade 2-hydroxy-3-phenyl-4H-pyrazino[1,2-a]pyrimidin-4-one |
| NCBI accession no. | NP_002508 |
| UniProt accession no. | Q99742 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... NPAS1(4861) |
