General description
The UDP-glucose pyrophosphorylase 2 (UGP2 ) gene is localized on human chromosome 2p15. It has a crucial role in carbohydrate metabolism. Its product uridine diphosphate-glucose (UDP-glucose) acts as a precursor for sugar nucleotides and is involved in various pathways. The enzyme is involved in the conversion of glucose-1-phosphate and MgUTP to UDP-glucose and MgPPi.
Immunogen
UGP2 (NP_001001521, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI
Application
Monoclonal Anti-UGP2 antibody produced in mouse has been used in Western blotting.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 3H3, monoclonal |
| form | buffered aqueous solution |
| species reactivity | human, rat, mouse |
| technique(s) | indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2aκ |
| GenBank accession no. | NM_001001521 |
| UniProt accession no. | Q16851 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... UGP2(7360) |
