General description
B-cell translocation gene 2 (BTG2) belongs to the BTG/TOB gene family. It is also called as nerve growth factor (NGF)-inducible anti-proliferative protein PC3 and NGF-inducible protein TIS21. BTG2 encodes a 158 amino acid protein. This gene is located on the long arm of human chromosome 1.
Immunogen
Synthetic peptide directed towards the middle region of human BTG2
Biochem/physiol Actions
B-cell translocation gene 2 (BTG2) is an anti-proliferative protein. BTG2 modulates transcription regulation mediated by ESR1.
It participates in the modulation of cell cycle transition. It has the ability to repress the migration and invasion of osteosarcoma cells.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 17 kDa |
| species reactivity | rat, human |
| concentration | 0.5-1 mg/mL |
| technique(s) | immunoblotting: suitable |
| accession no. | NM_006763 |
| UniProt accession no. | P78543 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... BTG2(7832) |
