General description
HBB (hemoglobin subunit β) codes for a β-globin that consists of three exons. This gene is located on human chromosome 11p15. HBB is a serum protein that belongs to the histone-like protein family.
The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5′-epsilon -- gamma-G -- gamma-A -- delta -- beta--3′. (provided by RefSeq)
Immunogen
HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH
Biochem/physiol Actions
HBB (hemoglobin subunit β) participates in oxygen transport from the lung to various peripheral tissues. Mutation in HBB result in Sickle cell disease (SCD). Overexpression of HBB has been observed in patients with periodontal disease.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 2H3, monoclonal |
| form | buffered aqueous solution |
| species reactivity | human |
| technique(s) | ELISA: suitable,capture ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG3κ |
| GenBank accession no. | BC007075 |
| UniProt accession no. | P68871 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... HBB(3043) |

