General description
Oncostatin M receptor (OSMR) is a cell surface cytokine receptor. Oncostatin M and interleukin-31 are its ligands. The gene encoding this protein is localized on human chromosome 5p.
Immunogen
OSMR (NP_003990.1, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP
Biochem/physiol Actions
Oncostatin M receptor (OSMR) acts as an activator of janus kinase/signal transducers and activators of transcription (JAK/STAT) and mitogen-activated protein kinase pathway. Thus, it has a role in stimulating cytokines and inflammatory substances. Mutation in the OSMR gene has been linked to primary localized cutaneous amyloidosis.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 3E12, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~37.11 kDa |
| species reactivity | human |
| technique(s) | indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2bκ |
| NCBI accession no. | NM_003999 |
| UniProt accession no. | Q99650 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... OSMR(9180) |
