General description
Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Defects in VCL are the cause of cardiomyopathy dilated type 1W. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1).
PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.
Application
WB, IF/ICC, IP
| biological source | rabbit |
| Quality Level | 100 |
| material | colorless |
| clone | 9I3Y8, monoclonal |
| form | liquid |
| mol wt | 124 kDa |
| species reactivity | rat, human |
| concentration | 1.00 mg/mL |
| technique(s) | immunofluorescence: 1:50 - 1:200,immunoprecipitation (IP): 1:50 - 1:200,western blot: 1:500 - 1:2000 |
| color | colorless |
| isotype | IgG |
| immunogen sequence | DAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM |
| UniProt accession no. | P18206 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... VCL(7414) |

