General description
Rac family small GTPase 3 (RAC3) gene is located on human chromosome 17q25.3. RAC3 is expressed in neurons of ganglia and the central nervous system.
Immunogen
RAC3 (NP_005043.1, 1 a.a. ~ 192 a.a) full-length human protein.
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF
Biochem/physiol Actions
Rac family small GTPase 3 (RAC3) helps in intracellular signalling. RAC3 activity is regulated by breakpoint cluster region (Bcr). Rac3 is a potential therapeutic target for lung adenocarcinoma. Rac3 acts as a negative regulator of autophagy.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| species reactivity | human |
| technique(s) | western blot: 1 μg/mL |
| NCBI accession no. | NM_005052 |
| UniProt accession no. | P60763 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... RAC3(5881) |

