General description
Cadherin 1 (CDH1), a transmembrane glycoprotein is present on the epithelial cell surface. It comprises a single transmembrane region, large extracellular domain, and a short cytoplasmic domain. The CDH1 gene is mapped to human chromosome 16q22.1. It is expressed in the embryonic stage especially during lip and palate development.
Immunogen
CDH1 (NP_004351, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
Application
Monoclonal Anti-CDH1 antibody produced in mouse has been used in immunohistochemistry and western blotting. 1:2000
Biochem/physiol Actions
Cadherin 1 (CDH1) interacts with the actin cytoskeleton through its cytoplasmic domain. It plays a key role in epithelial cell-cell adhesion, maintaining tissue integrity, and migration of cells. CDH1 may also participate in the wingless (wnt) signal transduction pathway. Mutations in CDH1 are implicated in lobular breast cancer ovary cancer and blepharocheilodontic (BCD) syndrome characterized with cleft lip/palate, and ectodermal dysplasia.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 3F4, monoclonal |
| form | buffered aqueous solution |
| species reactivity | human |
| technique(s) | immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable,indirect ELISA: suitable,proximity ligation assay: suitable,western blot: 1-5 μg/mL |
| isotype | IgG1κ |
| GenBank accession no. | NM_004360 |
| UniProt accession no. | P12830 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... CDH1(999) |
