General description
NFKBIB is a NF-κB inhibitor that forms a complex with NF-κB and traps it in the cytoplasm. Serine phosphorylation in NFKBIB proteins activates its ubiquitin-mediated degradation. This subsequently facilitates the nuclear transport and functions of NF-κB proteins.
Rabbit Anti-NFKBIB antibody recognizes human, mouse, rat, canine, and bovine NFKBIB.
Immunogen
Synthetic peptide directed towards the N terminal region of human NFKBIB
Application
Rabbit Anti-NFKBIB antibody can be used for western blot applications at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM].
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTAL
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 38 kDa |
| species reactivity | rabbit, mouse, human, rat, guinea pig |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| web metadata keyword.default | 3,3-dimethyl-1,4-dihydrofuro[3,4-b]quinolin-9(3H)-one CAS number,3,3-dimethyl-1,4-dihydrofuro[3,4-b]quinolin-9(3H)-one MSDS,3,3-dimethyl-1,4-dihydrofuro[3,4-b]quinolin-9(3H)-one Sigma-Aldrich,3,3-dimethyl-1,4-dihydrofuro[3,4-b]quinolin-9(3H)-one analytical standard,3,3-dimethyl-1,4-dihydrofuro[3,4-b]quinolin-9(3H)-one chemical structure,3,3-dimethyl-1,4-dihydrofuro[3,4-b]quinolin-9(3H)-one for organic synthesis,3,3-dimethyl-1,4-dihydrofuro[3,4-b]quinolin-9(3H)-one titration reagent,3,3-dimethyl-1,4-dihydrofuro[3,4-b]quinolin-9(3H)-one usage in pharmaceuticals,3,3-dimethyl-1,4-dihydrofuro[3,4-b]quinolin-9(3H)-one,ACS grade 3,3-dimethyl-1,4-dihydrofuro[3,4-b]quinolin-9(3H)-one,high purity 3,3-dimethyl-1,4-dihydrofuro[3,4-b]quinolin-9(3H)-one,laboratory-grade 3,3-dimethyl-1,4-dihydrofuro[3,4-b]quinolin-9(3H)-one |
| NCBI accession no. | NP_002494 |
| UniProt accession no. | Q15653 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... NFKBIB(4793) |
