General description
The previously assigned protein identifier C9J8H4 has been merged into A1BQX2. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the middle region of human MARVELD2
Biochem/physiol Actions
Tight junctions (TJ) prevent leakage of solutes through the paracellular pathway of epithelial cells. MARVELD2, or tricellulin (TRIC), is an integral membrane protein concentrated at the vertically oriented TJ strands of tricellular contacts (Ikenouchi et
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 52kDa |
| species reactivity | bovine, pig, rat, human, horse, mouse |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunoblotting: suitable |
| NCBI accession no. | NM_144724 |
| UniProt accession no. | A1BQX2 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... MARVELD2(153562) |
