Immunogen
Synthetic peptide directed towards the N terminal region of mouse CITED4
Biochem/physiol Actions
Cited4 is a member of The CITED family proteins that bind to CBP/p300 transcriptional integrators through their conserved C-terminal acidic domain and function as coactivators. It also interacts with isoforms of the TFAP2 transcription factor, coactivating TFAP2-dependent transcription.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 20 kDa |
| species reactivity | rat, mouse, human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_062509 |
| UniProt accession no. | Q9WUL8 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | mouse ... CITED4(56222) |

