General description
Wilms tumor 1 (WT1) gene is located on 11p13 in the human chromosome.
Immunogen
Synthetic peptide directed towards the middle region of human WT1
Biochem/physiol Actions
WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system. WT1 has both oncogenic and tumor suppressor properties, and also acts as a transcription factor at the early organ developmental stage. WT1 regulates the mesenchyme and modulates the development of mesodermal organs. WT1 is known to cause kidney cancer or nephroblastoma in children. Mutations in WT1 causes diseases of urogenital system like Denys-Drash syndrome, Frasier syndrome. WT1 is being associated with haematological malignancies and solid tumours.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 56 kDa |
| species reactivity | human, rabbit, dog, rat, mouse |
| concentration | 0.5-1 mg/mL |
| technique(s) | immunoblotting: suitable,immunohistochemistry: suitable |
| accession no. | NM_024424 |
| UniProt accession no. | P19544 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... WT1(7490) |
