General description
ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits. It catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with a concomitant hydrolysis of ATP to ADP and phosphate. The product, acetyl-CoA, serves several important biosynthetic pathways, including lipogenesis and cholesterogenesis. In nervous tissue, ATP citrate-lyase may be involved in the biosynthesis of acetylcholine. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Dec 2014]
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1000-1101 of human ACLY (P53396).
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.
Application
WB, IF/ICC, IP
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| material | colorless |
| clone | 8A0V0, monoclonal |
| form | liquid |
| species reactivity | human, rat |
| concentration | 0.26 mg/mL |
| technique(s) | immunofluorescence: 1:50 - 1:200,immunoprecipitation (IP): 1:50 - 1:200,western blot: 1:500 - 1:2000 |
| color | colorless |
| isotype | IgG |
| immunogen sequence | ATPLLDYALEVEKITTSKKPNLILNVDGLIGVAFVDMLRNCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISYVLPEHMSM |
| UniProt accession no. | P53396 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... ACLY(47) |
