General description
The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it′s possible that this protein induces the chromatin condensation observed in this process. (provided by RefSeq)
Immunogen
STK4 (AAH05231, 1 a.a. ~ 39 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 1D7-8A10, monoclonal |
| form | buffered aqueous solution |
| species reactivity | human |
| technique(s) | immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable,indirect ELISA: suitable,indirect immunofluorescence: suitable,western blot: 1-5 μg/mL |
| isotype | IgG1κ |
| GenBank accession no. | BC005231 |
| UniProt accession no. | Q13043 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... STK4(6789) |
