General description
Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. A similar protein in rat interacts with glutamate transporter EAAT4 and modulates its glutamate transport activity. Expression of the rat protein induces the reorganization of the actin cytoskeleton and its overexpression induces the formation of membrane ruffling and filopodia. Two alternative transcripts encoding different isoforms have been described. (provided by RefSeq)
Immunogen
ARHGEF11 (AAH57394, 651 a.a. ~ 750 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLSTRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPE
Physical form
Solution in phosphate buffered saline, pH 7.4
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 2H7, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~37 kDa |
| species reactivity | human |
| technique(s) | capture ELISA: suitable,indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG1κ |
| NCBI accession no. | BC057394 |
| UniProt accession no. | O15085 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... ARHGEF11(9826) |

