General description
Mucin 5B (MUC5B) is a high molecular mass, heavily O-glycosylated gel-forming mucin. It is encoded by the gene mapped to human chromosome 11p15.5. MUC5B is found in bronchus glands, submaxillary glands, endocervix, gall bladder, and pancreas.
Immunogen
MUC5B (XP_039877.9, 4186 a.a. ~ 4295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV
Application
Monoclonal Anti-MUC5B antibody produced in mouse has been used in immunofluorescence .
Biochem/physiol Actions
MUC5B is salivary mucin that might contribute to the lubrication, hydration, pathogen exclusion, and viscoelastic properties of the whole saliva. The protein acts as a marker of mucous gland cells. Mouse MUC5B plays a vital role in maintaining immune homeostasis in the lungs. It is also involved in preventing infections in the airways and middle ear by facilitating mucociliary clearance (MCC). Mutation in the MUC5B gene leads to the development of idiopathic pulmonary fibrosis. Overexpression of the gene stimulates aggressive behavior of breast cancer MCF7 cells.
Physical form
Clear solution
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | ascites fluid |
| antibody product type | primary antibodies |
| clone | 8C11, monoclonal |
| mol wt | antigen ~38.21 kDa |
| species reactivity | human |
| technique(s) | indirect ELISA: suitable,western blot: 1:500-1:1000 |
| isotype | IgG2aκ |
| NCBI accession no. | XM_039877 |
| UniProt accession no. | Q9HC84 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... MUC5B(727897) |
