General description
The nicotinamide N-methyltransferase (NNMT) gene, spanning 16.5kb of genomic DNA with three exons and two introns, is mapped to human chromosome 11q23.1. The encoded protein consists of 264 amino acids with a predicted molecular mass of 29.6kDa. NNMT is expressed in cytoplasm.
Immunogen
NNMT (NP_006160.1, 1 a.a. ~ 264 a.a) full-length human protein.
Sequence
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
Biochem/physiol Actions
Nicotinamide N-methyltransferase (NNMT) is a cytosolic methyltransferase enzyme. It catalyzes the N-methylation of nicotinamide, pyridines and other structural analogs. Hence, it plays a vital role in the biotransformation and detoxification of various xenobiotic compounds. Altered expression of the gene is associated with the pathogenesis of various diseases such as acute lymphoblastic leukemia (ALL), parkinson′s disease, thyroid cancer, gastric cancer, colorectal cancer, lung, liver and oral carcinomas. In addition, variation in the gene might increase the risk of susceptibility to hyperlipidemia and migraine.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | antigen 29.6 kDa |
| species reactivity | human, mouse |
| technique(s) | western blot: 1 μg/mL |
| NCBI accession no. | NM_006169.2 |
| UniProt accession no. | P40261 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... NNMT(4837) |
