General description
CA4 (carbonic anhydrase IV) is a member of zinc metalloprotein family called carbonic anhydrases, which is made of 16 members. This protein is anchored to the plasma membrane through glycosyl-phosphatiydyl-inositol (GPI) moiety. It has a molecular weight of 35kDa. It is synthesized as a precursor of 312 amino acids, in endoplasmic reticulum and resides in the plasma membrane of endothelial and epithelial cells of multiple organs. This gene maps to human chromosome 17q23, spans 9.5kb, and has seven introns and eight exons.
Immunogen
Carbonic anhydrase 4 precursor recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
CA4 (carbonic anhydrase IV) is responsible for regulating the transport of CO2 and HCO3-, and thus, maintains the homeostasis of CO2 and HCO3-, as well as the pH of tissues. It is expressed in the choriocapillaries of eye and epithelium of kidney. In eye, it provides oxygen to retinal pigment epithelium (RPM), by catalyzing the reversible conversion of CO2 to HCO3-. This in turn nourishes the photoreceptor cells. Retinitis pigmentosa type 17 is caused by mutation leading to arginine being replaced by tryptophan (R14W) in the signal peptide of CA4.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST72182
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| technique(s) | immunohistochemistry: 1:200- 1:500 |
| immunogen sequence | VTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLA |
| web metadata keyword.default | Anti-CA-IV antibody,Anti-CA4 antibody 1mg vial,Anti-CA4 antibody for epithelial cell research,Anti-CA4 antibody for immunohistochemistry,Anti-CA4 antibody rabbit Sigma-Aldrich,Anti-CA4 antibody,Anti-Carbonate dehydratase IV antibody rabbit,Anti-Carbonic anhydrase IV antibody rabbit 1mg,Anti-Carbonic anhydrase IV precursor antibody rabbit,CA4 antibody 35kDa rabbit,CA4 antibody for endothelial cell studies,CA4 carbonic anhydrase IV antibody rabbit,immunohistochemistry Anti-CA4 antibody 1:200,rabbit Anti-Carbonic anhydrase IV research |
| UniProt accession no. | P22748 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... CA4(762) |

