Immunogen
Synthetic peptide directed towards the middle region of human SV2A
Application
Anti-SV2A antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.
Biochem/physiol Actions
SV2A (synaptic vesicle glycoprotein 2A) gene is a multi-pass membrane protein that belongs to major facilitator superfamily. It regulates the cytoplasmic Ca2+ levels in the nerve terminal during repetitive stimulation and facilitates the synaptic transmission. SV2A serves as a binding site for the antiepileptic drug levetiracetam and may decrease the neuronal excitability. Mutation in SV2A gene results in schizophrenia.
Other Notes
Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| mol wt | 83 kDa |
| species reactivity | human, guinea pig, mouse, bovine, horse, dog, rabbit, rat |
| packaging | pkg of 100 μL buffered aqueous solution,pkg of 50 μg lyophilized powder |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_055664 |
| UniProt accession no. | Q7L0J3 |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... SV2A(9900) |
