General description
Interleukin 1 receptor associated kinase 3 (IRAK3) belongs to the interleukin receptor associated kinase (IRAK) family that is capable of shuttling in and out of the nucleus. It is associated with monocytes and contains a kinase (homology) domain, signature death domain of the IRAK family, and a C-terminal domain. The IRAK3 gene is mapped to human chromosome 12q14.3.
Immunogen
IRAK3 (AAH57800, 497 a.a. ~ 596 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE
Biochem/physiol Actions
Interleukin 1 receptor associated kinase 3 (IRAK3) acts as an anti-inflammatory molecule and blocks IRAK-4,-1 signaling. It is also negatively regulated toll-like receptor/interleukin (IL)-1 receptor (Toll/IL-R) immune signal transduction. IRAK3 may be involved in the pathophysiology of the hepatocellular carcinoma.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 1A6, monoclonal |
| form | buffered aqueous solution |
| species reactivity | human |
| technique(s) | indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG1κ |
| GenBank accession no. | BC057800 |
| UniProt accession no. | Q9Y616 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... IRAK3(11213) |
