General description
BTN1A1 (butyrophilin, subfamily 1, member A1) belongs to the BTN gene family, which resides within the major histocompatibility complex class I region on gene 6p22.1. This protein is composed of 526 amino acids and has a hydrophobic signal sequence at its N-terminal, which is made of 26 amino acids. The signal peptide is cleaved off before the secretion of the protein. BTN1A1 also belongs to immunoglobulin (Ig) superfamily, where the Ig domains are present in the extracellular region. The protein has a transmembrane region and short heptad repeats in the cytoplasmic tail. It is predominantly expressed in the epithelium of lactating mammary gland.
Immunogen
Butyrophilin subfamily 1 member A1 precursor recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
BTN1A1 (butyrophilin, subfamily 1, member A1) is a milk protein which is secreted in milk in the lipid droplets. It controls the secretion of lipid droplets in milk, by interacting with xanthine dehydrogenase/oxidase, and acting either as a receptor or structural protein. Inactivation of this gene in mice leads to the formation of triacylglycerol pools in the cytoplasm. When present in dietary products, BTN1A1 leads to alterations in multiple sclerosis (MS). This is because of the similarity in the IgI domain of BTN1A1 and the IgV domain of myelin oligodendrocyte glycoprotein (MOG). MOG is the antigen for auto-antibodies, and is found on the myelin nerve sheath of MS patients.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST71881
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| technique(s) | immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable |
| immunogen sequence | DYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGA |
| web metadata keyword.default | BTN1A1 antibody for cell signaling studies,BTN1A1 antibody rabbit polyclonal,BTN1A1 immunohistochemistry grade antibody,BTN1A1 protein antibody for lab use,Sigma-Aldrich BTN1A1 antibody 461670.0,anti-BT antibody for formalin-fixed paraffin-embedded sections,anti-BTN1A1 antibody 500µg size,anti-BTN1A1 antibody for cancer research,anti-BTN1A1 antibody,anti-butyrophilin antibody rabbit source,anti-butyrophilin subfamily 1 member A1 antibody,high-quality anti-BTN1A1 antibody for research,rabbit anti-BTN1A1 antibody applications,rabbit anti-BTN1A1 antibody for immunohistochemistry |
| UniProt accession no. | Q13410 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... BTN1A1(696) |

