General description
Myeloid/lymphoid or mixed-lineage leukemia 4 (MLL4) is a histone-lysine N-methyltransferase widely expressed in the nucleus of multiple cell types. It contains a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET domain.
Immunogen
Synthetic peptide directed towards the N terminal region of human MLL4
Biochem/physiol Actions
MLL4 a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. MLL4 is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: WAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDEEEFQGFHSDEDVA
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 64 kDa |
| species reactivity | human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| web metadata keyword.default | Anti-MLL4 antibody for research,Anti-MLL4 antibody rabbit 1x PBS,Anti-Myeloid leukemia 4 antibody 1x PBS buffer,MLL4 (1F6) rabbit anti-body,MLL4 antibody Sigma-Aldrich 1x PBS,MLL4 antibody for histone methylation research,MLL4 antibody western blot application,MLL4 antibody with sodium azide and sucrose,MLL4 histone-lysine N-methyltransferase antibody,anti-MLL4 antibody for cell type studies,custom Anti-MLL4 antibody ordering options,high-quality Anti-MLL4 antibody for immunoassays,purified Anti-MLL4 antibody,rabbit polyclonal Anti-MLL4 antibody |
| NCBI accession no. | NP_055542 |
| UniProt accession no. | Q9UMN6-2 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... MLL4(9757) |
