General description
Lectin, mannose-binding 2 (LMAN2, VIP36) is an intracellular, integral membrane protein that functions as a lectin of the post-Golgi secretory pathway. LMAN2 facilitates the secretion of high mannose glycoproteins predominantly via the apical surface of cells.
Immunogen
Synthetic peptide directed towards the N terminal region of human LMAN2
Application
Anti-LMAN2 (AB1) polyclonal antibody is used to tag lectin, mannose-binding 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of lectin, mannose-binding 2 in the secretion of high mannose glycoproteins.
Biochem/physiol Actions
Anti-LMAN2 (AB1) polyclonal antibody reacts with zebrafish, bovine, human, rat, canine, and mouse lectin, mannose-binding 2 proteins.
LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 36 kDa |
| species reactivity | human, bovine, rabbit, rat, mouse, dog, horse, guinea pig |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| NCBI accession no. | NP_006807 |
| UniProt accession no. | Q12907 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... LMAN2(10960) |

