General description
SILu™Lite CST3 is a recombinant human protein expressed in E. coli. It consists of 120 amino acids, with a calculated molecular mass of 13.5 kDa. SILu™Lite CST3 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Biochem/physiol Actions
Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).
Physical form
Supplied as a lyophilized powder containing tris buffered saline and methionine.
Other Notes
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
| recombinant | expressed in E. coli |
| Quality Segment | 200 |
| assay | ≥95% (SDS-PAGE) |
| form | lyophilized powder |
| suitability | suitable for mass spectrometry (internal calibrator) |
| UniProt accession no. | P01034 (aa 27-146) |
| shipped in | ambient |
| storage temp. | −20°C |
| Gene Information | human ... CST3(1471) |
