General description
TNK1 (Tyrosine kinase, non-receptor, 1) is a novel 72kDa nonreceptor tyrosine kinase protein beloniging to the ACK (Activated CDC42 kinase) family of non-receptor tyrosine kinases. It consists of an N-terminal kinase domain, a putative Src Homology 3 (SH3) domain at the C-terminal end, and a proline-rich tail. TNK1 is expressed in all fetal tissues such as cord blood, bone marrow and adult tissues such as prostate, testis, ovary, small intestine and colon. In addition to normal tissues, its expression also have been found in the several leukemia cell lines.
Immunogen
Non-receptor tyrosine-protein kinase TNK1 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
TNK1 (Tyrosine kinase, non-receptor, 1) is majorly involved in the phospholipid signaling pathways. In addition to the kinase activity, it also negetively regulates Ras-Raf1-MAPK pathway. Studies have been suggested that TNK1 may possess tumor suppressor like properties as well as capacity of tumor necrosis factor-α-induced apoptosis. It may participate in various signaling pathways during fetal development and growth.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST71457
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| technique(s) | immunohistochemistry: 1:20- 1:50 |
| immunogen sequence | PSEACCVRDVTEPGALRMETGDPITVIEGSPDSTIWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWDAPPARGQRRNMPLERMKGISRSLESVLSLG |
| UniProt accession no. | Q13470 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... TNK1(8711) |

