Immunogen
Synthetic peptide directed towards the N terminal region of human CCT6B
Application
Anti-CCT6B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
T-complex protein 1 subunit zeta-2 is a protein encoded by the CCT6B gene in humans. CCT6B [chaperonin containing TCP1, subunit 6B (zeta 2)] encodes a molecular chaperone that belongs to TCP-1 chaperonin family. This subunit is an integral component of TCP1 ring complex (TRiC) that plays a pivotal role in folding newly synthesized cytosolic proteins and preventing protein aggregation.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 58 kDa |
| species reactivity | guinea pig, human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_006575 |
| UniProt accession no. | Q92526 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... CCT6B(10693) |
