General description
ZNF512 is a protein that may have four zinc finger motifs that probably interact with nucleic acid or proteins. Rabbit Anti-ZNF512 antibody binds to bovine, human, mouse, and rat ZNF512.
Immunogen
Synthetic peptide directed towards the middle region of human ZNF512
Application
Rabbit Anti-ZNF512 antibody can be used for western blot (0.5μg/ml) applications.
Biochem/physiol Actions
ZNF512 is a new candidate transcription factor.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: QLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERERLRTVLKRLGKLRCM
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 65 kDa |
| species reactivity | bovine, guinea pig, human, horse |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_115810 |
| UniProt accession no. | Q96ME7 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... ZNF512(84450) |
