General description
Serpin peptidase inhibitor, clade A member 3 (SERPINA3) is also termed as α1-antichymotrypsin (α1-ACT). It is a 68 kDa serine protease inhibitor, secreted by the liver. It belongs to the serpin superfamily of protease inhibitors. SERPINA3 is located on human chromosome 14q32.1.
Immunogen
Synthetic peptide directed towards the middle region of human SERPINA3
Biochem/physiol Actions
Serpin peptidase inhibitor, clade A member 3 (SERPINA3) can block the functions of various serine proteases like chymotrypsin and cathepsin G. It serves as a novel predictor of clinical outcomes and a potential therapeutic target of EC (endometrial carcinoma). SERPINA3 plays a major role in melanoma invasion and migration in extracellular matrix.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: FRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSL
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 45kDa |
| species reactivity | human, mouse, rat |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunoblotting: suitable |
| NCBI accession no. | NM_001085 |
| UniProt accession no. | P01011 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... SERPINA3(12) |

