Immunogen
Synthetic peptide directed towards the middle region of human TRIP4
Biochem/physiol Actions
TRIP4, also referred to as human activating signal cointegrator 1 (hASC-1), is a transcriptional coactivator of nuclear receptors. The ASC-1 complex is a transactivator for NF-κB, AP-1 and SRF signaling. The expression of TRIP4 acts as a marker of disease progression for Alzheimer′s disease.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: VCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKV
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 66 kDa |
| species reactivity | guinea pig, dog, bovine, mouse, rat, rabbit, human, horse |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_057297 |
| UniProt accession no. | Q15650 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... TRIP4(9325) |
