Immunogen
Synthetic peptide directed towards the C terminal region of human NOL6
Biochem/physiol Actions
NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 22 kDa |
| species reactivity | human, guinea pig, rat |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| web metadata keyword.default | 1x PBS Anti-NOL6 antibody with sodium azide,Anti-NOL6 antibody 2% sucrose formulation,Anti-NOL6 antibody for research laboratories,Anti-NOL6 antibody rabbit 1x PBS buffer,Anti-NOL6 antibody rabbit,Anti-Nucleolar protein family 6 antibody,NOL6 antibody Sigma-Aldrich,NOL6 antibody for immunohistochemistry applications,NOL6 antibody western blot suitable,NOL6 rabbit antibody for western blot,high-purity Anti-NOL6 antibody,immunohistochemistry Anti-NOL6 antibody,purified Anti-NOL6 antibody,rabbit Anti-NOL6 antibody research use only |
| NCBI accession no. | NP_075068 |
| UniProt accession no. | Q9H6R4 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... NOL6(65083) |
