General description
The gene cathepsin B (CTSB) has been mapped to human chromosome 8p22. The gene encodes a lysosomal cysteine protease composed of a dimer of disulphide linked heavy and light chains. Under physiological conditions the protein is localized in lysosomes and in presence of some cellular signals it is released from the lysosomes and trigger different physiological events.
Immunogen
Cathepsin B precursor recombinant protein epitope signature tag (PrEST)
Application
Anti-CTSB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
Cathepsin B (CTSB) has been linked to various responses including lysosomal protein turnover, apoptosis and immune responses. The protein is involved in activation of epithelial Na+ channel in cystic fibrosis lung disease airways. Presence of cocaine along with HIV (human immunodeficiency virus)-1 infection causes increase in CTSB secretion and neurotoxicity. CTSB is up-regulated in synovial fluid of patients suffering with rheumatoid arthritis. The protein is considered as a biomarker for many cancers. Stearoyl-CoA desaturase-5 reduces melanoma malignancy by regulating secretion of CTSB. Mutations in CTSB (C76G/A4383C) have been linked to high risk of hepatocellular carcinoma. CTSB levels and activity were shown to be increased in human esophageal squamous cell carcinoma, breast cancer, colorectal carcinomas and no small cell lung carcinoma. CTSB increase the localization of cytoplasmic c-Jun-NH2-terminus kinase, thereby inducing migration of glioma cells and making them more malignant.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST73333
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| enhanced validation | orthogonal RNAseq Learn more about Antibody Enhanced Validation |
| technique(s) | immunofluorescence: 0.25-2 μg/mL,immunohistochemistry: 1:500-1:1000 |
| immunogen sequence | DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA |
| UniProt accession no. | P07858 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... CTSB(1508) |

