General description
Carbonic anhydrase III (CA3) is a member of a multi-gene CA family that encodes carbonic anhydrase isozymes and termed as Car3 and CAIII. The expression of isoform has shown an increased abundance during muscle aging and is relatively muscle specific. It exhibits a fibre type-specific expression pattern.
Immunogen
Carbonic anhydrase 3 recombinant protein epitope signature tag (PrEST)
Application
Anti-CA3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
Carbonic anhydrase III (CA3) may act as a new biomarker of sarcopenia. Higher CA levels indicate an increased demand of CO2 removal in senescent muscle and the age-related fibre type shifts to slower-contracting muscles during human aging. CA3 is found to be associated with rheumatoid arthritis. CA3 possesses low carbon dioxide hydratase activity, resistance to the CA inhibitor acetazolamide unlike other members of the CA family.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST74712
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| enhanced validation | orthogonal RNAseq independent Learn more about Antibody Enhanced Validation |
| technique(s) | immunohistochemistry: 1:200-1:500,western blot: 0.04-0.4 μg/mL |
| immunogen sequence | DHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYR |
| UniProt accession no. | P07451 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... CA3(761) |

