General description
Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse COX subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene COX6CP1 has been found on chromosomes 16p12. (provided by RefSeq)
Immunogen
COX6C (AAH00187, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
Physical form
Solution in phosphate buffered saline, pH 7.4
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | S51, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~34.36 kDa |
| species reactivity | human |
| technique(s) | capture ELISA: suitable,immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable,indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG1κ |
| NCBI accession no. | BC000187 |
| UniProt accession no. | P09669 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... COX6C(1345) |
