Immunogen
Synthetic peptide directed towards the N terminal region of human CLCC1
Application
Anti-CLCC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Biochem/physiol Actions
Chloride channel CLIC-like 1 (CLCC1; Mid-1 related chloride channel, MCLC) belongs to the family of chloride channels present at the plasma membrane and membranes of intracellular compartments. They are involved in the regulation of cell volume and acidification of intracellular compartments. Chloride channels may modulate cell growth and apoptosis. CLCC1 is expressed in membranes of endoplasmic reticulum, Golgi apparatus, and nucleus.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 61 kDa |
| species reactivity | dog, human, rabbit, mouse, pig, rat, bovine |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| NCBI accession no. | NP_001041675 |
| UniProt accession no. | Q96S66 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... CLCC1(23155) |

