Immunogen
Synthetic peptide directed towards the N terminal region of human FNDC3B
Application
Anti-FNDC3B antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.
Biochem/physiol Actions
Fibronectin type III domain containing 3B (FNDC3B; FAD104) is a positive regulator of adipogenesis and is highly expressed in the early stage of adipogenesis. FNDC3B gene is reportedly associated with primary open-angle glaucoma.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 44 kDa |
| species reactivity | rabbit, horse, rat, dog, human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| web metadata keyword.default | Anti-DKFZp686D14170 antibody rabbit,Anti-FNDC3B antibody Sigma-Aldrich,Anti-FNDC3B antibody rabbit 2.5µg/ml western blot,Anti-FNDC3B antibody sodium azide formulation,Anti-FNDC3B antibody western blot reagent,Anti-FNDC3B antibody,Anti-Fibronectin type III domain containing 3B antibody,FNDC3B antibody for research use only,FNDC3B antibody western blotting,purified Anti-FNDC3B antibody 1x PBS sodium azide,purified Anti-FNDC3B antibody,rabbit Anti-FNDC3B antibody western blot application,research grade Anti-FNDC3B antibody for western blotting,synthetic peptide Anti-FNDC3B antibody |
| NCBI accession no. | NP_001128567 |
| UniProt accession no. | Q53EP0 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... FNDC3B(64778) |
