General description
T-box transcription factor 18 (TBX18) belongs to the TBX family of transcription factors. It contains a conserved T-box domain and an N-terminal nuclear localization signal (NLS). The TBX18 gene is mapped to human chromosome 6q14.3
Immunogen
TBX18 (XP_496819, 454 a.a. ~ 560 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
Application
ANTI-TBX18 antibody produced in mouse has been used in immunofluorescence staining.
Biochem/physiol Actions
T-box transcription factor 18 (TBX18) is involved in the sinoatrial node (SAN) formation and is expressed in the development and differentiation stages. It is a crucial factor for the pacemaker cell formation from cardiomyocytes. TBX18 may be implicated in congenital heart defects and congenital anomalies of the kidneys and urinary tract (CAKUT).
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 4D3, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen 37.4 kDa |
| species reactivity | , human |
| technique(s) | indirect ELISA: suitable,indirect immunofluorescence: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2aκ |
| NCBI accession no. | XM_496819 |
| UniProt accession no. | O95935 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... TBX18(9096) |

