General description
Sodium-dependent phosphate transporter 1 (SLC20A1) protein is an inorganic phosphate transporter and a sodium-phosphate symporter. It is expressed in the plasma membrane and belongs to the inorganic phosphate transporter family (PiT). Also called PIT1, it is an N-linked glycosylated protein with N and C termini placed in the extracellular region. It comprises 12 transmembrane domains. SLC20A1 gene is mapped to human chromosome 2q14.1.
Immunogen
Synthetic peptide directed towards the C terminal region of human SLC20A1
Application
Anti-SLC20A1 antibody produced in rabbit has been used in western blotting (1:1000).
Biochem/physiol Actions
Anti-SLC20A1 polyclonal antibody reacts with canine and human solute carrier family 20 (phosphate transporter) member 1 proteins.
Sodium-dependent phosphate transporter 1 (SLC20A1) protein is a high-affinity sodium (Na+)-phosphate (Pi) co-transporter that imports inorganic phosphate (Pi). It serves as a receptor for gibbon ape leukemia virus (GALV), feline leukemia virus type B (FeLV-B), woolly monkey virus and 10A1 murine leukemia virus, making it crucial for viral entry. SLC20A1 is essential for urinary tract and urorectal development. Variants ofSLC20A1 gene are implicated in the pathophysiology of bladder exstrophy-epispadias complex (BEEC) and in cloacal exstrophy. It may also participate in normal growth and development of the liver. Elevated expression of SLC20A1 gene is correlated to the activation of the wingless (Wnt)/β-catenin signaling pathway in somatotroph adenomas. SLC20A1 protein may participate in tumor necrosis factor-induced apoptosis and regulate cell proliferation, erythroid and B cell differentiation.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 74 kDa |
| species reactivity | pig, dog, horse, bovine, human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_005406 |
| UniProt accession no. | Q8WUM9 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... SLC20A1(6574) |
