Immunogen
Synthetic peptide directed towards the middle region of human TMEM173
Biochem/physiol Actions
TMEM173 acts as a facilitator of innate immune signaling. It is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. TMEM173 may be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons.It also may be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). TMEM173 mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 42 kDa |
| species reactivity | human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| UniProt accession no. | Q86WV6 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... TMEM173(340061) |
