Immunogen
Synthetic peptide directed towards the middle region of human JPH2
Application
Anti-JPH2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
Biochem/physiol Actions
Junctophilin 2 (JPH2; CMH17) is a member of the junctophilin family. The members of this family form the junctional complexes present between the plasma membrane and the endoplasmic/sarcoplasmic reticululm. JPH2 couples the sarcolemmal and the intracellular calcium channels in the skeletal and cardiac muscle. The expression of JPH2 is essential for the formation of postnatal T-tubule in mammals. Dysregulation of junctophilins result in a variety of cardiac disorders.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 74 kDa |
| species reactivity | dog, human, horse, guinea pig, bovine, rat, mouse |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_065166 |
| UniProt accession no. | Q9BR39 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... JPH2(57158) |
