General description
ZNF652 is a zinc-finger protein that associates with CBFA2T3 and supresses transcription. It has also been studied as a prognostic biomarker for vulvar carcinomas.
Rabbit Anti-ZNF652 antibody recognizes human, mouse, rat, and canine ZNF652.
Immunogen
Synthetic peptide directed towards the N terminal region of human ZNF652
Application
Rabbit Anti-ZNF652 can be used for western blot applications at 0.5μg/ml.
Biochem/physiol Actions
ZNF652 is a new candidate transcription factor.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: RENSDDTEEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQSKETPV
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 70 kDa |
| species reactivity | human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| NCBI accession no. | NP_055712 |
| UniProt accession no. | Q9Y2D9 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... ZNF652(22834) |
