General description
This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2).
PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.
Application
WB, FC
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| material | colorless |
| clone | 5S2F7, monoclonal |
| form | liquid |
| mol wt | 80-130 kDa |
| species reactivity | human, rat |
| concentration | 1 mg/mL |
| technique(s) | flow cytometry: 1:50 - 1:200,western blot: 1:500 - 1:1000 |
| color | colorless |
| isotype | IgG |
| immunogen sequence | TSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNK |
| UniProt accession no. | P34810 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... CD68(968) |

