Immunogen
Synthetic peptide directed towards the middle region of human HES4
Biochem/physiol Actions
HES4 has been identified as transcriptional repressor that is positively regulated by Wnt signaling pathway. In conjunction with Notch signaling targets, Hes proteins regulate cell differentiation, embryonic patterning and cell fate decisions.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: GHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLA
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 24 kDa |
| species reactivity | human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_001135939 |
| UniProt accession no. | Q9HCC6 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... HES4(57801) |
