General description
Interferon regulatory factor 4 (IRF4), also known as multiple myeloma oncogene-1 (MUM1), is a transcription factor. It is encoded by the gene mapped to human chromosome 6p25.3. The protein is specifically expressed in lymphocytes.
Immunogen
IRF4 (NP_002451, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
Biochem/physiol Actions
Interferon regulatory factor 4 (IRF4) plays a vital role in regulation of immunoglobulin class switch recombination and plasma cell differentiation. In addition, it is also implicated in maintaining homeostasis of both mature B and mature T lymphocytes. Mutation in the gene is associated with the risk of developing chronic lymphocytic leukemia (CLL).
Physical form
Solution in phosphate buffered saline, pH 7.4
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 2D1, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~38.21 kDa |
| species reactivity | human |
| technique(s) | capture ELISA: suitable,indirect ELISA: suitable,indirect immunofluorescence: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2bκ |
| NCBI accession no. | NM_002460 |
| UniProt accession no. | Q15306 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... IRF4(3662) |
